SETD7,KIAA1717,KMT7
  • SETD7,KIAA1717,KMT7

Anti-SETD7 Antibody 25ul

Ref: AN-HPA058111-25ul
Anti-SETD7

Información del producto

Polyclonal Antibody against Human SETD7, Gene description: SET domain containing (lysine methyltransferase) 7, Alternative Gene Names: KIAA1717, KMT7, SET7, SET7/9, Set9, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WTS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SETD7
Gene Description SET domain containing (lysine methyltransferase) 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS
Immunogen TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1717, KMT7, SET7, SET7/9, Set9
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WTS6
HTS Code 3002150000
Gene ID 80854
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SETD7 Antibody 25ul

Anti-SETD7 Antibody 25ul