GNLY,D2S69E,LAG-2
  • GNLY,D2S69E,LAG-2

Anti-GNLY Antibody 100ul

Ref: AN-HPA058021-100ul
Anti-GNLY

Información del producto

Polyclonal Antibody against Human GNLY, Gene description: granulysin, Alternative Gene Names: D2S69E, LAG-2, LAG2, NKG5, TLA519, Validated applications: IHC, Uniprot ID: P22749, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GNLY
Gene Description granulysin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKP
Immunogen RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D2S69E, LAG-2, LAG2, NKG5, TLA519
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22749
HTS Code 3002150000
Gene ID 10578
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GNLY Antibody 100ul

Anti-GNLY Antibody 100ul