MEMO1,C2orf4,CGI-27
  • MEMO1,C2orf4,CGI-27

Anti-MEMO1 Antibody 25ul

Ref: AN-HPA057952-25ul
Anti-MEMO1

Información del producto

Polyclonal Antibody against Human MEMO1, Gene description: mediator of cell motility 1, Alternative Gene Names: C2orf4, CGI-27, MEMO, Validated applications: ICC, Uniprot ID: Q9Y316, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MEMO1
Gene Description mediator of cell motility 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRI
Immunogen MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf4, CGI-27, MEMO
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y316
HTS Code 3002150000
Gene ID 51072
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MEMO1 Antibody 25ul

Anti-MEMO1 Antibody 25ul