SEC13,D3S1231E
  • SEC13,D3S1231E

Anti-SEC13 Antibody 100ul

Ref: AN-HPA057943-100ul
Anti-SEC13

Información del producto

Polyclonal Antibody against Human SEC13, Gene description: SEC13 homolog, nuclear pore and COPII coat complex component, Alternative Gene Names: D3S1231E, npp-20, SEC13L1, SEC13R, Validated applications: ICC, Uniprot ID: P55735, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEC13
Gene Description SEC13 homolog, nuclear pore and COPII coat complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD
Immunogen IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D3S1231E, npp-20, SEC13L1, SEC13R
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55735
HTS Code 3002150000
Gene ID 6396
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SEC13 Antibody 100ul

Anti-SEC13 Antibody 100ul