RNF103,hkf-1,KF1
  • RNF103,hkf-1,KF1

Anti-RNF103 Antibody 25ul

Ref: AN-HPA057922-25ul
Anti-RNF103

Información del producto

Polyclonal Antibody against Human RNF103, Gene description: ring finger protein 103, Alternative Gene Names: hkf-1, KF1, ZFP103, Validated applications: IHC, Uniprot ID: O00237, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF103
Gene Description ring finger protein 103
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
Immunogen YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hkf-1, KF1, ZFP103
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00237
HTS Code 3002150000
Gene ID 7844
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RNF103 Antibody 25ul

Anti-RNF103 Antibody 25ul