RAPGEF5,GFR
  • RAPGEF5,GFR

Anti-RAPGEF5 Antibody 100ul

Ref: AN-HPA057821-100ul
Anti-RAPGEF5

Información del producto

Polyclonal Antibody against Human RAPGEF5, Gene description: Rap guanine nucleotide exchange factor (GEF) 5, Alternative Gene Names: GFR, KIAA0277, MR-GEF, Validated applications: IHC, Uniprot ID: Q92565, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAPGEF5
Gene Description Rap guanine nucleotide exchange factor (GEF) 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EEDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDL
Immunogen EEDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GFR, KIAA0277, MR-GEF
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92565
HTS Code 3002150000
Gene ID 9771
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAPGEF5 Antibody 100ul

Anti-RAPGEF5 Antibody 100ul