SLC35B3,C6orf196
  • SLC35B3,C6orf196

Anti-SLC35B3 Antibody 25ul

Ref: AN-HPA057801-25ul
Anti-SLC35B3

Información del producto

Polyclonal Antibody against Human SLC35B3, Gene description: solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3, Alternative Gene Names: C6orf196, CGI-19, dJ453H5.1, PAPST2, Validated applications: IHC, Uniprot ID: Q9H1N7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC35B3
Gene Description solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL
Immunogen QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf196, CGI-19, dJ453H5.1, PAPST2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1N7
HTS Code 3002150000
Gene ID 51000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC35B3 Antibody 25ul

Anti-SLC35B3 Antibody 25ul