ZNF644,BM-005
  • ZNF644,BM-005

Anti-ZNF644 Antibody 100ul

Ref: AN-HPA057795-100ul
Anti-ZNF644

Información del producto

Polyclonal Antibody against Human ZNF644, Gene description: zinc finger protein 644, Alternative Gene Names: BM-005, KIAA1221, MGC60165, MGC70410, Validated applications: IHC, Uniprot ID: Q9H582, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF644
Gene Description zinc finger protein 644
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NGPVSHSSLTKTSNMNKGSVSLTTGQPVDQPTTESCSTLKVAADLQLSTPQKASQHQVLFLLSDVAHAKNPTHSNKKLPTSASVGCDIQNSVGSNIKS
Immunogen NGPVSHSSLTKTSNMNKGSVSLTTGQPVDQPTTESCSTLKVAADLQLSTPQKASQHQVLFLLSDVAHAKNPTHSNKKLPTSASVGCDIQNSVGSNIKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BM-005, KIAA1221, MGC60165, MGC70410
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H582
HTS Code 3002150000
Gene ID 84146
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF644 Antibody 100ul

Anti-ZNF644 Antibody 100ul