BMP7,OP-1
  • BMP7,OP-1

Anti-BMP7 Antibody 100ul

Ref: AN-HPA057757-100ul
Anti-BMP7

Información del producto

Polyclonal Antibody against Human BMP7, Gene description: bone morphogenetic protein 7, Alternative Gene Names: OP-1, Validated applications: ICC, Uniprot ID: P18075, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BMP7
Gene Description bone morphogenetic protein 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH
Immunogen AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names OP-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P18075
HTS Code 3002150000
Gene ID 655
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BMP7 Antibody 100ul

Anti-BMP7 Antibody 100ul