GDI1,FLJ41411,GDIL
  • GDI1,FLJ41411,GDIL

Anti-GDI1 Antibody 25ul

Ref: AN-HPA057668-25ul
Anti-GDI1

Información del producto

Polyclonal Antibody against Human GDI1, Gene description: GDP dissociation inhibitor 1, Alternative Gene Names: FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4, Validated applications: IHC, Uniprot ID: P31150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GDI1
Gene Description GDP dissociation inhibitor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK
Immunogen RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P31150
HTS Code 3002150000
Gene ID 2664
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GDI1 Antibody 25ul

Anti-GDI1 Antibody 25ul