C20orf24,PNAS-11
  • C20orf24,PNAS-11

Anti-C20orf24 Antibody 100ul

Ref: AN-HPA057387-100ul
Anti-C20orf24

Información del producto

Polyclonal Antibody against Human C20orf24, Gene description: chromosome 20 open reading frame 24, Alternative Gene Names: PNAS-11, RIP5, Validated applications: ICC, IHC, Uniprot ID: Q9BUV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C20orf24
Gene Description chromosome 20 open reading frame 24
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
Immunogen KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PNAS-11, RIP5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BUV8
HTS Code 3002150000
Gene ID 55969
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C20orf24 Antibody 100ul

Anti-C20orf24 Antibody 100ul