FBXL13,Fbl13
  • FBXL13,Fbl13

Anti-FBXL13 Antibody 25ul

Ref: AN-HPA057232-25ul
Anti-FBXL13

Información del producto

Polyclonal Antibody against Human FBXL13, Gene description: F-box and leucine-rich repeat protein 13, Alternative Gene Names: Fbl13, MGC21636, Validated applications: IHC, Uniprot ID: Q8NEE6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FBXL13
Gene Description F-box and leucine-rich repeat protein 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCV
Immunogen GNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Fbl13, MGC21636
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NEE6
HTS Code 3002150000
Gene ID 222235
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FBXL13 Antibody 25ul

Anti-FBXL13 Antibody 25ul