UBE2S,E2-EPF
  • UBE2S,E2-EPF

Anti-UBE2S Antibody 25ul

Ref: AN-HPA057150-25ul
Anti-UBE2S

Información del producto

Polyclonal Antibody against Human UBE2S, Gene description: ubiquitin-conjugating enzyme E2S, Alternative Gene Names: E2-EPF, Validated applications: ICC, IHC, Uniprot ID: Q16763, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UBE2S
Gene Description ubiquitin-conjugating enzyme E2S
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN
Immunogen MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E2-EPF
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16763
HTS Code 3002150000
Gene ID 27338
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBE2S Antibody 25ul

Anti-UBE2S Antibody 25ul