NT5C3B,MGC20781
  • NT5C3B,MGC20781

Anti-NT5C3B Antibody 100ul

Ref: AN-HPA057095-100ul
Anti-NT5C3B

Información del producto

Polyclonal Antibody against Human NT5C3B, Gene description: 5'-nucleotidase, cytosolic IIIB, Alternative Gene Names: MGC20781, NT5C3L, Validated applications: IHC, Uniprot ID: Q969T7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NT5C3B
Gene Description 5'-nucleotidase, cytosolic IIIB
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQLEGKTNVILLGDSIG
Immunogen IVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQLEGKTNVILLGDSIG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC20781, NT5C3L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969T7
HTS Code 3002150000
Gene ID 115024
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NT5C3B Antibody 100ul

Anti-NT5C3B Antibody 100ul