RASL10B,RRP17
  • RASL10B,RRP17

Anti-RASL10B Antibody 25ul

Ref: AN-HPA057092-25ul
Anti-RASL10B

Información del producto

Polyclonal Antibody against Human RASL10B, Gene description: RAS-like, family 10, member B, Alternative Gene Names: RRP17, VTS58635, Validated applications: ICC, IHC, Uniprot ID: Q96S79, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RASL10B
Gene Description RAS-like, family 10, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
Immunogen KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RRP17, VTS58635
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96S79
HTS Code 3002150000
Gene ID 91608
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RASL10B Antibody 25ul

Anti-RASL10B Antibody 25ul