TNFAIP8,GG2-1
  • TNFAIP8,GG2-1

Anti-TNFAIP8 Antibody 25ul

Ref: AN-HPA057089-25ul
Anti-TNFAIP8

Información del producto

Polyclonal Antibody against Human TNFAIP8, Gene description: tumor necrosis factor, alpha-induced protein 8, Alternative Gene Names: GG2-1, MDC-3.13, SCC-S2, Validated applications: ICC, IHC, WB, Uniprot ID: O95379, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TNFAIP8
Gene Description tumor necrosis factor, alpha-induced protein 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Immunogen AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GG2-1, MDC-3.13, SCC-S2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95379
HTS Code 3002150000
Gene ID 25816
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TNFAIP8 Antibody 25ul

Anti-TNFAIP8 Antibody 25ul