ABHD14A
  • ABHD14A

Anti-ABHD14A Antibody 25ul

Ref: AN-HPA056913-25ul
Anti-ABHD14A

Información del producto

Polyclonal Antibody against Human ABHD14A, Gene description: abhydrolase domain containing 14A, Alternative Gene Names: DKFZP564O243, DORZ1, Validated applications: ICC, Uniprot ID: Q9BUJ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ABHD14A
Gene Description abhydrolase domain containing 14A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
Immunogen NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP564O243, DORZ1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BUJ0
HTS Code 3002150000
Gene ID 25864
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ABHD14A Antibody 25ul

Anti-ABHD14A Antibody 25ul