DYRK2
  • DYRK2

Anti-DYRK2 Antibody 25ul

Ref: AN-HPA056902-25ul
Anti-DYRK2

Información del producto

Polyclonal Antibody against Human DYRK2, Gene description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2, Validated applications: ICC, Uniprot ID: Q92630, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DYRK2
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPN
Immunogen IALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92630
HTS Code 3002150000
Gene ID 8445
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DYRK2 Antibody 25ul

Anti-DYRK2 Antibody 25ul