ARPP19,ARPP-16
  • ARPP19,ARPP-16

Anti-ARPP19 Antibody 100ul

Ref: AN-HPA056851-100ul
Anti-ARPP19

Información del producto

Polyclonal Antibody against Human ARPP19, Gene description: cAMP-regulated phosphoprotein, 19kDa, Alternative Gene Names: ARPP-16, ARPP-19, ARPP16, ENSAL, Validated applications: IHC, Uniprot ID: P56211, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARPP19
Gene Description cAMP-regulated phosphoprotein, 19kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK
Immunogen MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARPP-16, ARPP-19, ARPP16, ENSAL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P56211
HTS Code 3002150000
Gene ID 10776
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARPP19 Antibody 100ul

Anti-ARPP19 Antibody 100ul