THSD7B,KIAA1679
  • THSD7B,KIAA1679

Anti-THSD7B Antibody 100ul

Ref: AN-HPA056745-100ul
Anti-THSD7B

Información del producto

Polyclonal Antibody against Human THSD7B, Gene description: thrombospondin, type I, domain containing 7B, Alternative Gene Names: KIAA1679, Validated applications: ICC, Uniprot ID: Q9C0I4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name THSD7B
Gene Description thrombospondin, type I, domain containing 7B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PTQGEGRPCPTELTQEKTCPVTPCYSWVLGNWSACKLEGGDCGEGVQIRSLSCMVHSGSISHAAGRVEDALCGEMPFQDSILKQLCSV
Immunogen PTQGEGRPCPTELTQEKTCPVTPCYSWVLGNWSACKLEGGDCGEGVQIRSLSCMVHSGSISHAAGRVEDALCGEMPFQDSILKQLCSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1679
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0I4
HTS Code 3002150000
Gene ID 80731
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-THSD7B Antibody 100ul

Anti-THSD7B Antibody 100ul