MARCH5,FLJ20445
  • MARCH5,FLJ20445

Anti-MARCH5 Antibody 25ul

Ref: AN-HPA056596-25ul
Anti-MARCH5

Información del producto

Polyclonal Antibody against Human MARCH5, Gene description: membrane-associated ring finger (C3HC4) 5, Alternative Gene Names: FLJ20445, MARCH-V, RNF153, Validated applications: ICC, Uniprot ID: Q9NX47, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MARCH5
Gene Description membrane-associated ring finger (C3HC4) 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLA
Immunogen PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20445, MARCH-V, RNF153
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NX47
HTS Code 3002150000
Gene ID 54708
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MARCH5 Antibody 25ul

Anti-MARCH5 Antibody 25ul