FOXC2,FKHL14,MFH-1
  • FOXC2,FKHL14,MFH-1

Anti-FOXC2 Antibody 100ul

Ref: AN-HPA056302-100ul
Anti-FOXC2

Información del producto

Polyclonal Antibody against Human FOXC2, Gene description: forkhead box C2, Alternative Gene Names: FKHL14, MFH-1, Validated applications: ICC, Uniprot ID: Q99958, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FOXC2
Gene Description forkhead box C2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK
Immunogen SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKHL14, MFH-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99958
HTS Code 3002150000
Gene ID 2303
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FOXC2 Antibody 100ul

Anti-FOXC2 Antibody 100ul