UGT3A1,FLJ34658
  • UGT3A1,FLJ34658

Anti-UGT3A1 Antibody 25ul

Ref: AN-HPA056290-25ul
Anti-UGT3A1

Información del producto

Polyclonal Antibody against Human UGT3A1, Gene description: UDP glycosyltransferase 3 family, polypeptide A1, Alternative Gene Names: FLJ34658, Validated applications: IHC, Uniprot ID: Q6NUS8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UGT3A1
Gene Description UDP glycosyltransferase 3 family, polypeptide A1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM
Immunogen KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ34658
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NUS8
HTS Code 3002150000
Gene ID 133688
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UGT3A1 Antibody 25ul

Anti-UGT3A1 Antibody 25ul