H2BFWT
  • H2BFWT

Anti-H2BFWT Antibody 25ul

Ref: AN-HPA056289-25ul
Anti-H2BFWT

Información del producto

Polyclonal Antibody against Human H2BFWT, Gene description: H2B histone family, member W, testis-specific, Validated applications: IHC, Uniprot ID: Q7Z2G1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name H2BFWT
Gene Description H2B histone family, member W, testis-specific
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVL
Immunogen PKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z2G1
HTS Code 3002150000
Gene ID 158983
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-H2BFWT Antibody 25ul

Anti-H2BFWT Antibody 25ul