MBTPS1,KIAA0091
  • MBTPS1,KIAA0091

Anti-MBTPS1 Antibody 100ul

Ref: AN-HPA056109-100ul
Anti-MBTPS1

Información del producto

Polyclonal Antibody against Human MBTPS1, Gene description: membrane-bound transcription factor peptidase, site 1, Alternative Gene Names: KIAA0091, PCSK8, S1P, SKI-1, Validated applications: IHC, Uniprot ID: Q14703, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MBTPS1
Gene Description membrane-bound transcription factor peptidase, site 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSV
Immunogen YPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0091, PCSK8, S1P, SKI-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14703
HTS Code 3002150000
Gene ID 8720
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MBTPS1 Antibody 100ul

Anti-MBTPS1 Antibody 100ul