MPC2,BRP44
  • MPC2,BRP44

Anti-MPC2 Antibody 100ul

Ref: AN-HPA056091-100ul
Anti-MPC2

Información del producto

Polyclonal Antibody against Human MPC2, Gene description: mitochondrial pyruvate carrier 2, Alternative Gene Names: BRP44, DKFZP564B167, Validated applications: IHC, Uniprot ID: O95563, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MPC2
Gene Description mitochondrial pyruvate carrier 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV
Immunogen EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRP44, DKFZP564B167
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95563
HTS Code 3002150000
Gene ID 25874
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MPC2 Antibody 100ul

Anti-MPC2 Antibody 100ul