HABP4,IHABP4,SERBP1L
  • HABP4,IHABP4,SERBP1L

Anti-HABP4 Antibody 25ul

Ref: AN-HPA055969-25ul
Anti-HABP4

Información del producto

Polyclonal Antibody against Human HABP4, Gene description: hyaluronan binding protein 4, Alternative Gene Names: IHABP4, SERBP1L, Validated applications: IHC, Uniprot ID: Q5JVS0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HABP4
Gene Description hyaluronan binding protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPE
Immunogen RGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IHABP4, SERBP1L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5JVS0
HTS Code 3002150000
Gene ID 22927
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HABP4 Antibody 25ul

Anti-HABP4 Antibody 25ul