FAM120A,C9orf10
  • FAM120A,C9orf10

Anti-FAM120A Antibody 25ul

Ref: AN-HPA055800-25ul
Anti-FAM120A

Información del producto

Polyclonal Antibody against Human FAM120A, Gene description: family with sequence similarity 120A, Alternative Gene Names: C9orf10, DNAPTP1, KIAA0183, OSSA, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NZB2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM120A
Gene Description family with sequence similarity 120A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP
Immunogen FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf10, DNAPTP1, KIAA0183, OSSA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZB2
HTS Code 3002150000
Gene ID 23196
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM120A Antibody 25ul

Anti-FAM120A Antibody 25ul