MRPS5,MRP-S5,S5mt
  • MRPS5,MRP-S5,S5mt

Anti-MRPS5 Antibody 25ul

Ref: AN-HPA055765-25ul
Anti-MRPS5

Información del producto

Polyclonal Antibody against Human MRPS5, Gene description: mitochondrial ribosomal protein S5, Alternative Gene Names: MRP-S5, S5mt, Validated applications: ICC, IHC, WB, Uniprot ID: P82675, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPS5
Gene Description mitochondrial ribosomal protein S5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
Immunogen QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MRP-S5, S5mt
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P82675
HTS Code 3002150000
Gene ID 64969
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPS5 Antibody 25ul

Anti-MRPS5 Antibody 25ul