HOXC12,HOC3F,HOX3
  • HOXC12,HOC3F,HOX3

Anti-HOXC12 Antibody 25ul

Ref: AN-HPA055632-25ul
Anti-HOXC12

Información del producto

Polyclonal Antibody against Human HOXC12, Gene description: homeobox C12, Alternative Gene Names: HOC3F, HOX3, HOX3F, Validated applications: IHC, Uniprot ID: P31275, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HOXC12
Gene Description homeobox C12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPF
Immunogen LLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HOC3F, HOX3, HOX3F
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P31275
HTS Code 3002150000
Gene ID 3228
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HOXC12 Antibody 25ul

Anti-HOXC12 Antibody 25ul