STRAP,MAWD,pt-wd
  • STRAP,MAWD,pt-wd

Anti-STRAP Antibody 100ul

Ref: AN-HPA055557-100ul
Anti-STRAP

Información del producto

Polyclonal Antibody against Human STRAP, Gene description: serine/threonine kinase receptor associated protein, Alternative Gene Names: MAWD, pt-wd, UNRIP, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3F4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STRAP
Gene Description serine/threonine kinase receptor associated protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence FNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGP
Immunogen FNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MAWD, pt-wd, UNRIP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3F4
HTS Code 3002150000
Gene ID 11171
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STRAP Antibody 100ul

Anti-STRAP Antibody 100ul