SNRPC,U1-C,Yhc1
  • SNRPC,U1-C,Yhc1

Anti-SNRPC Antibody 100ul

Ref: AN-HPA055490-100ul
Anti-SNRPC

Información del producto

Polyclonal Antibody against Human SNRPC, Gene description: small nuclear ribonucleoprotein polypeptide C, Alternative Gene Names: U1-C, Yhc1, Validated applications: ICC, IHC, WB, Uniprot ID: P09234, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNRPC
Gene Description small nuclear ribonucleoprotein polypeptide C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP
Immunogen VKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names U1-C, Yhc1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09234
HTS Code 3002150000
Gene ID 6631
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNRPC Antibody 100ul

Anti-SNRPC Antibody 100ul