PIDD1,DKFZp434D229
  • PIDD1,DKFZp434D229

Anti-PIDD1 Antibody 25ul

Ref: AN-HPA055473-25ul
Anti-PIDD1

Información del producto

Polyclonal Antibody against Human PIDD1, Gene description: p53-induced death domain protein 1, Alternative Gene Names: DKFZp434D229, LRDD, MGC16925, PIDD, Validated applications: ICC, Uniprot ID: Q9HB75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PIDD1
Gene Description p53-induced death domain protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SFPVTPRGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVV
Immunogen SFPVTPRGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434D229, LRDD, MGC16925, PIDD
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HB75
HTS Code 3002150000
Gene ID 55367
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PIDD1 Antibody 25ul

Anti-PIDD1 Antibody 25ul