ALDH8A1,ALDH12
  • ALDH8A1,ALDH12

Anti-ALDH8A1 Antibody 25ul

Ref: AN-HPA055414-25ul
Anti-ALDH8A1

Información del producto

Polyclonal Antibody against Human ALDH8A1, Gene description: aldehyde dehydrogenase 8 family, member A1, Alternative Gene Names: ALDH12, Validated applications: ICC, IHC, Uniprot ID: Q9H2A2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ALDH8A1
Gene Description aldehyde dehydrogenase 8 family, member A1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW
Immunogen AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALDH12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2A2
HTS Code 3002150000
Gene ID 64577
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ALDH8A1 Antibody 25ul

Anti-ALDH8A1 Antibody 25ul