IFIT1,G10P1,GARG-16
  • IFIT1,G10P1,GARG-16

Anti-IFIT1 Antibody 100ul

Ref: AN-HPA055380-100ul
Anti-IFIT1

Información del producto

Polyclonal Antibody against Human IFIT1, Gene description: interferon-induced protein with tetratricopeptide repeats 1, Alternative Gene Names: G10P1, GARG-16, IFI56, IFNAI1, Validated applications: ICC, IHC, Uniprot ID: P09914, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IFIT1
Gene Description interferon-induced protein with tetratricopeptide repeats 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH
Immunogen KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names G10P1, GARG-16, IFI56, IFNAI1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09914
HTS Code 3002150000
Gene ID 3434
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IFIT1 Antibody 100ul

Anti-IFIT1 Antibody 100ul