PGPEP1,Pcp,PGP
  • PGPEP1,Pcp,PGP

Anti-PGPEP1 Antibody 25ul

Ref: AN-HPA055277-25ul
Anti-PGPEP1

Información del producto

Polyclonal Antibody against Human PGPEP1, Gene description: pyroglutamyl-peptidase I, Alternative Gene Names: Pcp, PGP, PGP-I, PGPI, Validated applications: ICC, Uniprot ID: Q9NXJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PGPEP1
Gene Description pyroglutamyl-peptidase I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHS
Immunogen MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Pcp, PGP, PGP-I, PGPI
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXJ5
HTS Code 3002150000
Gene ID 54858
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PGPEP1 Antibody 25ul

Anti-PGPEP1 Antibody 25ul