B3GNT4,B3GN-T4
  • B3GNT4,B3GN-T4

Anti-B3GNT4 Antibody 25ul

Ref: AN-HPA055261-25ul
Anti-B3GNT4

Información del producto

Polyclonal Antibody against Human B3GNT4, Gene description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4, Alternative Gene Names: B3GN-T4, beta3Gn-T4, Validated applications: ICC, IHC, Uniprot ID: Q9C0J1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name B3GNT4
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK
Immunogen TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B3GN-T4, beta3Gn-T4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0J1
HTS Code 3002150000
Gene ID 79369
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-B3GNT4 Antibody 25ul

Anti-B3GNT4 Antibody 25ul