SYNE3,C14orf49
  • SYNE3,C14orf49

Anti-SYNE3 Antibody 100ul

Ref: AN-HPA055227-100ul
Anti-SYNE3

Información del producto

Polyclonal Antibody against Human SYNE3, Gene description: spectrin repeat containing, nuclear envelope family member 3, Alternative Gene Names: C14orf49, FLJ25605, Nesp3, Nesprin-3, NET53, Validated applications: IHC, WB, Uniprot ID: Q6ZMZ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SYNE3
Gene Description spectrin repeat containing, nuclear envelope family member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MKAEYDAVKAKAQKRVDLLEQVAREHEEYQAGVDEFQLWLKAVVEKVNGCLGRNCKLPITQRLSTLQDIAKDFPRGEESLETLEEQSAGVIRNTSP
Immunogen MKAEYDAVKAKAQKRVDLLEQVAREHEEYQAGVDEFQLWLKAVVEKVNGCLGRNCKLPITQRLSTLQDIAKDFPRGEESLETLEEQSAGVIRNTSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf49, FLJ25605, Nesp3, Nesprin-3, NET53
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZMZ3
HTS Code 3002150000
Gene ID 161176
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SYNE3 Antibody 100ul

Anti-SYNE3 Antibody 100ul