SPSB2,GRCC9,SSB-2
  • SPSB2,GRCC9,SSB-2

Anti-SPSB2 Antibody 25ul

Ref: AN-HPA055225-25ul
Anti-SPSB2

Información del producto

Polyclonal Antibody against Human SPSB2, Gene description: splA/ryanodine receptor domain and SOCS box containing 2, Alternative Gene Names: GRCC9, SSB-2, Validated applications: IHC, Uniprot ID: Q99619, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPSB2
Gene Description splA/ryanodine receptor domain and SOCS box containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
Immunogen MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GRCC9, SSB-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99619
HTS Code 3002150000
Gene ID 84727
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPSB2 Antibody 25ul

Anti-SPSB2 Antibody 25ul