TCFL5,bHLHe82,CHA
  • TCFL5,bHLHe82,CHA

Anti-TCFL5 Antibody 25ul

Ref: AN-HPA055223-25ul
Anti-TCFL5

Información del producto

Polyclonal Antibody against Human TCFL5, Gene description: transcription factor-like 5 (basic helix-loop-helix), Alternative Gene Names: bHLHe82, CHA, E2BP-1, Figlb, Validated applications: ICC, IHC, Uniprot ID: Q9UL49, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCFL5
Gene Description transcription factor-like 5 (basic helix-loop-helix)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
Immunogen KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHe82, CHA, E2BP-1, Figlb
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UL49
HTS Code 3002150000
Gene ID 10732
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TCFL5 Antibody 25ul

Anti-TCFL5 Antibody 25ul