TTC9C,MGC29649
  • TTC9C,MGC29649

Anti-TTC9C Antibody 25ul

Ref: AN-HPA055169-25ul
Anti-TTC9C

Información del producto

Polyclonal Antibody against Human TTC9C, Gene description: tetratricopeptide repeat domain 9C, Alternative Gene Names: MGC29649, Validated applications: ICC, IHC, Uniprot ID: Q8N5M4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TTC9C
Gene Description tetratricopeptide repeat domain 9C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCY
Immunogen MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC29649
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N5M4
HTS Code 3002150000
Gene ID 283237
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TTC9C Antibody 25ul

Anti-TTC9C Antibody 25ul