CCDC28A,C6orf80
  • CCDC28A,C6orf80

Anti-CCDC28A Antibody 100ul

Ref: AN-HPA055125-100ul
Anti-CCDC28A

Información del producto

Polyclonal Antibody against Human CCDC28A, Gene description: coiled-coil domain containing 28A, Alternative Gene Names: C6orf80, CCRL1AP, DKFZp586D0623, Validated applications: ICC, IHC, Uniprot ID: Q8IWP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC28A
Gene Description coiled-coil domain containing 28A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSA
Immunogen LARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf80, CCRL1AP, DKFZp586D0623
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWP9
HTS Code 3002150000
Gene ID 25901
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC28A Antibody 100ul

Anti-CCDC28A Antibody 100ul