OMA1,FLJ33782
  • OMA1,FLJ33782

Anti-OMA1 Antibody 25ul

Ref: AN-HPA055120-25ul
Anti-OMA1

Información del producto

Polyclonal Antibody against Human OMA1, Gene description: OMA1 zinc metallopeptidase, Alternative Gene Names: FLJ33782, MPRP-1, YKR087C, ZMPOMA1, Validated applications: ICC, IHC, Uniprot ID: Q96E52, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OMA1
Gene Description OMA1 zinc metallopeptidase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Immunogen YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ33782, MPRP-1, YKR087C, ZMPOMA1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96E52
HTS Code 3002150000
Gene ID 115209
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OMA1 Antibody 25ul

Anti-OMA1 Antibody 25ul