ZNRD1,HTEX-6,hZR14
  • ZNRD1,HTEX-6,hZR14

Anti-ZNRD1 Antibody 100ul

Ref: AN-HPA055074-100ul
Anti-ZNRD1

Información del producto

Polyclonal Antibody against Human ZNRD1, Gene description: zinc ribbon domain containing 1, Alternative Gene Names: HTEX-6, hZR14, RPA12, tctex-6, Validated applications: ICC, Uniprot ID: Q9P1U0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNRD1
Gene Description zinc ribbon domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCT
Immunogen CIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HTEX-6, hZR14, RPA12, tctex-6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P1U0
HTS Code 3002150000
Gene ID 30834
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNRD1 Antibody 100ul

Anti-ZNRD1 Antibody 100ul