VGLL3,VGL-3
  • VGLL3,VGL-3

Anti-VGLL3 Antibody 100ul

Ref: AN-HPA054983-100ul
Anti-VGLL3

Información del producto

Polyclonal Antibody against Human VGLL3, Gene description: vestigial-like family member 3, Alternative Gene Names: VGL-3, Validated applications: ICC, Uniprot ID: A8MV65, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VGLL3
Gene Description vestigial-like family member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQE
Immunogen CAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names VGL-3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A8MV65
HTS Code 3002150000
Gene ID 389136
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VGLL3 Antibody 100ul

Anti-VGLL3 Antibody 100ul