CENPQ,C6orf139
  • CENPQ,C6orf139

Anti-CENPQ Antibody 100ul

Ref: AN-HPA054965-100ul
Anti-CENPQ

Información del producto

Polyclonal Antibody against Human CENPQ, Gene description: centromere protein Q, Alternative Gene Names: C6orf139, CENP-Q, FLJ10545, Validated applications: ICC, Uniprot ID: Q7L2Z9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPQ
Gene Description centromere protein Q
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI
Immunogen VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf139, CENP-Q, FLJ10545
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L2Z9
HTS Code 3002150000
Gene ID 55166
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CENPQ Antibody 100ul

Anti-CENPQ Antibody 100ul