DENND2C,dJ1156J9.1
  • DENND2C,dJ1156J9.1

Anti-DENND2C Antibody 25ul

Ref: AN-HPA054955-25ul
Anti-DENND2C

Información del producto

Polyclonal Antibody against Human DENND2C, Gene description: DENN/MADD domain containing 2C, Alternative Gene Names: dJ1156J9.1, DKFZp686G0351, DKFZp779P1149, FLJ37099, RP5-1156J9.1, Validated applications: ICC, IHC, Uniprot ID: Q68D51, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DENND2C
Gene Description DENN/MADD domain containing 2C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence WEGRANGISNPEKWCPKDFGVRYNCHQEIRLKKNPIAERKSKNLDVTSRENVGLDINENTKSHDQSENENKKHEYDDTHFFKNESESNWVCSRVKEIESCKED
Immunogen WEGRANGISNPEKWCPKDFGVRYNCHQEIRLKKNPIAERKSKNLDVTSRENVGLDINENTKSHDQSENENKKHEYDDTHFFKNESESNWVCSRVKEIESCKED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ1156J9.1, DKFZp686G0351, DKFZp779P1149, FLJ37099, RP5-1156J9.1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q68D51
HTS Code 3002150000
Gene ID 163259
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DENND2C Antibody 25ul

Anti-DENND2C Antibody 25ul