RAI1,DKFZP434A139
  • RAI1,DKFZP434A139

Anti-RAI1 Antibody 100ul

Ref: AN-HPA054906-100ul
Anti-RAI1

Información del producto

Polyclonal Antibody against Human RAI1, Gene description: retinoic acid induced 1, Alternative Gene Names: DKFZP434A139, KIAA1820, MGC12824, SMCR, SMS, Validated applications: ICC, IHC, Uniprot ID: Q7Z5J4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAI1
Gene Description retinoic acid induced 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEEGLVNVGTGQKLPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGTALAPKKRSRKGRAGAHGLSKGPLEKRPYLGPAL
Immunogen TSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEEGLVNVGTGQKLPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGTALAPKKRSRKGRAGAHGLSKGPLEKRPYLGPAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434A139, KIAA1820, MGC12824, SMCR, SMS
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z5J4
HTS Code 3002150000
Gene ID 10743
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAI1 Antibody 100ul

Anti-RAI1 Antibody 100ul