LRRC4C,KIAA1580
  • LRRC4C,KIAA1580

Anti-LRRC4C Antibody 100ul

Ref: AN-HPA054800-100ul
Anti-LRRC4C

Información del producto

Polyclonal Antibody against Human LRRC4C, Gene description: leucine rich repeat containing 4C, Alternative Gene Names: KIAA1580, NGL-1, Validated applications: ICC, Uniprot ID: Q9HCJ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LRRC4C
Gene Description leucine rich repeat containing 4C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
Immunogen NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1580, NGL-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCJ2
HTS Code 3002150000
Gene ID 57689
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LRRC4C Antibody 100ul

Anti-LRRC4C Antibody 100ul