FAM65C,C20orf175
  • FAM65C,C20orf175

Anti-FAM65C Antibody 100ul

Ref: AN-HPA054759-100ul
Anti-FAM65C

Información del producto

Polyclonal Antibody against Human FAM65C, Gene description: family with sequence similarity 65, member C, Alternative Gene Names: C20orf175, C20orf176, dJ530I15.2, dJ530I15.3, Validated applications: IHC, Uniprot ID: Q96MK2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM65C
Gene Description family with sequence similarity 65, member C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IITWFQFHSYLQRQSVSDLEKHFTQLTKEVTLIEELHCAGQAKVVRKLQGKRLGQLQPLPQTLRAWALLQLDGTPRVCRAASARLAGAVRNRSFREK
Immunogen IITWFQFHSYLQRQSVSDLEKHFTQLTKEVTLIEELHCAGQAKVVRKLQGKRLGQLQPLPQTLRAWALLQLDGTPRVCRAASARLAGAVRNRSFREK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf175, C20orf176, dJ530I15.2, dJ530I15.3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MK2
HTS Code 3002150000
Gene ID 140876
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM65C Antibody 100ul

Anti-FAM65C Antibody 100ul